PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g011440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 308aa    MW: 34304.6 Da    PI: 8.1433
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g011440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.11.6e-20226260135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  Csa17g011440.1 226 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 260
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.85E-15219282No hitNo description
SMARTSM004017.2E-20220270IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.4E-15224257IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.084224256IPR000679Zinc finger, GATA-type
CDDcd002021.01E-17225274No hitNo description
PROSITE patternPS003440226251IPR000679Zinc finger, GATA-type
PfamPF003202.6E-18226260IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGSMNWLPEQ EEDFKGILSD DFFDDLINNL DCPLDEDDID TTNAPEDWVA KFQDLEPPPM  60
DMFPSLPSHL TSLAKPARLA VPPFLVQKQS SSSEALSGIH SSTLNQSSSP PDIKVSKLFQ  120
SSSPVSVLVN SCDSLSPQNS RSQGLAFPVK GIRSKRRRPT TMRLNYLFPF DEPKKPEKFT  180
PGESRSQSYY SSEQHAKKKR KIQLTATHTV SSSFEAINSD GIVRKCTHCE TTKTPQWREG  240
PNGPKTLCNA CGVRFRSGRL VPEYRPASSP TFIPSVHSNS HRKIIEMRRK DDNQFDTSMM  300
HAVISGA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010475585.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010475586.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-157GAT11_ARATH; GATA transcription factor 11
TrEMBLR0IF881e-176R0IF88_9BRAS; Uncharacterized protein
STRINGAT1G08010.11e-154(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-138GATA transcription factor 11